PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P21600_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 277aa    MW: 30622.4 Da    PI: 10.3131
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P21600_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-18128182256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ +++k+q  +Lee F+ +++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  GSMUA_Achr4P21600_001 128 RKKLRLSKDQSAILEESFKAHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 182
                            788899***********************************************98 PP

2HD-ZIP_I/II121.93.1e-39128216190
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rlsk+q+++LEesF+++++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d e Lkr++d+l+een+rL+kev+eLr
  GSMUA_Achr4P21600_001 128 RKKLRLSKDQSAILEESFKAHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTETDRELLKRCCDTLTEENRRLQKEVRELR 215
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 ee 90 
                             +
  GSMUA_Achr4P21600_001 216 -D 216
                            .4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046186.0E-262108IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.607.1E-18102185IPR009057Homeodomain-like
SuperFamilySSF466892.1E-18117185IPR009057Homeodomain-like
PROSITE profilePS5007117.119124184IPR001356Homeobox domain
SMARTSM003893.7E-16126188IPR001356Homeobox domain
CDDcd000867.24E-15128185No hitNo description
PfamPF000465.9E-16128182IPR001356Homeobox domain
PROSITE patternPS000270159182IPR017970Homeobox, conserved site
SMARTSM003402.9E-19184227IPR003106Leucine zipper, homeobox-associated
PfamPF021831.4E-7184217IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MMMGKDDLGL SLSLSSSNLN LQLNLMPPSS SPASGPSTSP SFYRHQKGRW SDLVVHSAAE  60
SRPGPLLRGV DVNWTPPGGE ERNSGEDAGA SSPNSTLSSV SGKRAEQDLQ GPASSRGVSD  120
EEDAEGSRKK LRLSKDQSAI LEESFKAHNT LNPKQKLALA KQLNLRPRQV EVWFQNRRAR  180
TKLKQTETDR ELLKRCCDTL TEENRRLQKE VRELRDLKLS GPQCYMHTTP PTTLSLCPSC  240
ERISNSATTT AVFHRSRPFS MPIRRVLSSA HANRSSS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126132SRKKLRL
2176184RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009398498.11e-172PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054662e-80HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLM0SQX30.0M0SQX3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P21600_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.14e-54homeobox protein 2